Structure of PDB 4j19 Chain B Binding Site BS02

Receptor Information
>4j19 Chain B (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLS
DLERVTSLKVYNWFANRRKEIKRRAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j19 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R267 R271 F272 W274 K325 N332
Binding residue
(residue number reindexed from 1)		R1 R5 F6 W8 K59 N66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003691 double-stranded telomeric DNA binding

View graph for
Molecular Function
External links
PDB RCSB:4j19, PDBe:4j19, PDBj:4j19
PDBsum4j19
PubMed23685356
UniProtQ6NT76|HMBX1_HUMAN Homeobox-containing protein 1 (Gene Name=HMBOX1)

[Back to BioLiP]