Structure of PDB 4irk Chain B Binding Site BS02

Receptor Information

>4irk Chain B (length=342) Species: 83333 (Escherichia coli K-12)

GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPAR
KFGVRSAMPTGMALALCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEP
LSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLA
KIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRT
CGDVQACDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTM
AEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTT
QEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDP

Ligand information

>4irk Chain G (length=14)

gggtcctaggaccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4irk A strategically located serine residue is critical for the mutator activity of DNA polymerase IV from Escherichia coli.
• Resolution: 2.32 Å
• Binding residue (original residue number in PDB): K150 P182 G183 G185 V187 S188 R285 T298 Q300 E301 H302 V303 R323
• Binding residue (residue number reindexed from 1): K151 P183 G184 G186 V188 S189 R286 T299 Q301 E302 H303 V304 R324

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0005515 protein binding
• GO:0008296 3'-5'-DNA exonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000731 DNA synthesis involved in DNA repair
• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0009432 SOS response
• GO:0042276 error-prone translesion synthesis
• GO:0070987 error-free translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4irk, PDBe:4irk, PDBj:4irk
• PDBsum: 4irk
• PubMed: 23525461
• UniProt: Q47155|DPO4_ECOLI DNA polymerase IV (Gene Name=dinB)