Structure of PDB 4iim Chain B Binding Site BS02

Receptor Information
>4iim Chain B (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKS
YVKLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iim Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Q946 D947 M948 W949 W960
Binding residue
(residue number reindexed from 1)		Q32 D33 M34 W35 W46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4iim, PDBe:4iim, PDBj:4iim
PDBsum4iim
PubMed
UniProtQ15811|ITSN1_HUMAN Intersectin-1 (Gene Name=ITSN1)

[Back to BioLiP]