Structure of PDB 4i2o Chain B Binding Site BS02

Receptor Information
>4i2o Chain B (length=198) Species: 375 (Bradyrhizobium japonicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVATEFSYRKDEEIYGEDEPAEYVYQVVTGAVRSYKLLSDGRRQIGAFHL
PGDVFGLESGPSHRLAAEAIIDTSVRLVKRSSLEKAAGIDVQVARKLWAM
TAGELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMSRRDI
GDYLGLTLETVSRALSQLHTQGILGFSGARQIVLRNRQRLHNLDAAAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i2o The Structure of Bradyrhizobium japonicum Transcription Factor FixK2 Unveils Sites of DNA Binding and Oxidation.
Resolution1.77 Å
Binding residue
(original residue number in PDB)		S183 R184 S199 R200 S203 A216 R217
Binding residue
(residue number reindexed from 1)		S146 R147 S162 R163 S166 A179 R180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4i2o, PDBe:4i2o, PDBj:4i2o
PDBsum4i2o
PubMed23546876
UniProtO69245

[Back to BioLiP]