Structure of PDB 4hf2 Chain B Binding Site BS02

Receptor Information
>4hf2 Chain B (length=121) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLAQLFSRLR
KNGLVSSVRGPGGGYLLGKDASSIAVGEVISAVDGGDKALTHALWRDLSD
RLTGFLNNITLGELVNNQEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hf2 Studies of IscR reveal a unique mechanism for metal-dependent regulation of DNA binding specificity.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		R2 S38 S40 Y41 Q44 R59 G60 P61
Binding residue
(residue number reindexed from 1)		R2 S38 S40 Y41 Q44 R59 G60 P61
Binding affinityPDBbind-CN: Kd=22nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005506 iron ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hf2, PDBe:4hf2, PDBj:4hf2
PDBsum4hf2
PubMed23644595
UniProtP0AGK8|ISCR_ECOLI HTH-type transcriptional regulator IscR (Gene Name=iscR)

[Back to BioLiP]