Structure of PDB 4hc7 Chain B Binding Site BS02

Receptor Information
>4hc7 Chain B (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKGTSCA
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hc7 DNA Binding by GATA Transcription Factor Suggests Mechanisms of DNA Looping and Long-Range Gene Regulation.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		L274 R276 R277 Y283 K293 N340 L344 Y345 H349 R353 M357 Q363 T364 R365
Binding residue
(residue number reindexed from 1)		L16 R18 R19 Y25 K35 N71 L75 Y76 H80 R84 M88 Q94 T95 R96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hc7, PDBe:4hc7, PDBj:4hc7
PDBsum4hc7
PubMed23142663
UniProtP23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=GATA3)

[Back to BioLiP]