Structure of PDB 4fx4 Chain B Binding Site BS02

Receptor Information
>4fx4 Chain B (length=133) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSTMSELAARI
GVERTTLTRNLEVMRRDGLVRVMAGADARCKRIELTAKGRAALQKAVPLW
RGVQAEVTASVGDWPRVRRDIANLGQAAEACRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4fx4 The Oxidation-sensing Regulator (MosR) Is a New Redox-dependent Transcription Factor in Mycobacterium tuberculosis.
Resolution3.1001 Å
Binding residue
(original residue number in PDB)
R16 R20 Q24 M59 S60 R70 T74 R75 R95 C96 K97
Binding residue
(residue number reindexed from 1)
R8 R12 Q16 M43 S44 R54 T58 R59 R79 C80 K81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4fx4, PDBe:4fx4, PDBj:4fx4
PDBsum4fx4
PubMed22992749
UniProtO53397

[Back to BioLiP]