Structure of PDB 4enn Chain B Binding Site BS02

Receptor Information
>4enn Chain B (length=108) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHP
ETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLN
LPEYMWKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4enn Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
Resolution2.8448 Å
Binding residue
(original residue number in PDB)		M3 S36 Y37 R39 Q40
Binding residue
(residue number reindexed from 1)		M3 S36 Y37 R39 Q40
Binding affinityPDBbind-CN: Kd=0.71nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
GO:0032132 O6-alkylguanine-DNA binding
Biological Process
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4enn, PDBe:4enn, PDBj:4enn
PDBsum4enn
PubMed22658721
UniProtQ9UTN9|ATL1_SCHPO Alkyltransferase-like protein 1 (Gene Name=atl1)

[Back to BioLiP]