Structure of PDB 4egy Chain B Binding Site BS02

Receptor Information

>4egy Chain B (length=70) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAI
GDLVSQGLLYSVQGGGTFVA

Ligand information

>4egy Chain U (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaattgttcgtacaaatatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4egy Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
Resolution	2.301 Å
Binding residue (original residue number in PDB)	P3 K4 Y5 S40 H42 T43 Q61 G62 G63
Binding residue (residue number reindexed from 1)	P5 K6 Y7 S42 H44 T45 Q63 G64 G65
Binding affinity	PDBbind-CN: Kd=250nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4egy, PDBe:4egy, PDBj:4egy
PDBsum	4egy
PubMed	23109551
UniProt	P96711\|ARAR_BACSU Arabinose metabolism transcriptional repressor (Gene Name=araR)

[Back to BioLiP]