Structure of PDB 4e54 Chain B Binding Site BS02

Receptor Information
>4e54 Chain B (length=402) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSI
VRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAW
HPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNT
NQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTG
DNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKI
WDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQ
WDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPNFKSCTPYEL
RTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWS
QQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4e54 Damaged DNA induced UV-damaged DNA-binding protein (UV-DDB) dimerization and its roles in chromatinized DNA repair.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R112 A155 N201 W203 V263 Q308 Q335 H336
Binding residue
(residue number reindexed from 1)		R93 A136 N182 W184 V244 Q289 Q316 H317
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0000209 protein polyubiquitination
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006290 pyrimidine dimer repair
GO:0006974 DNA damage response
GO:0009411 response to UV
GO:0016567 protein ubiquitination
GO:0034644 cellular response to UV
GO:0051865 protein autoubiquitination
GO:0070914 UV-damage excision repair
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0030054 cell junction
GO:0031464 Cul4A-RING E3 ubiquitin ligase complex
GO:0031465 Cul4B-RING E3 ubiquitin ligase complex
GO:0032991 protein-containing complex
GO:0080008 Cul4-RING E3 ubiquitin ligase complex
GO:0090734 site of DNA damage

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4e54, PDBe:4e54, PDBj:4e54
PDBsum4e54
PubMed22822215
UniProtQ92466|DDB2_HUMAN DNA damage-binding protein 2 (Gene Name=DDB2)

[Back to BioLiP]