Structure of PDB 4d49 Chain B Binding Site BS02

Receptor Information
>4d49 Chain B (length=238) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKL
LDDASEEVIKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEV
IKEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAI
ANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIKEAVWAIANIASGNN
EMKQKLEEAGALPALEKLQSHANEEVQKNAQAALEAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d49 Computationally Designed Armadillo Repeat Proteins for Modular Peptide Recognition.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		S40 N79 S82 G83 N85 I88 W117 N121 S124 G125 N126 N127 E156 W159 N163 A165 S166 G167 I172 W201 N205 S208 G209
Binding residue
(residue number reindexed from 1)		S29 N68 S71 G72 N74 I77 W106 N110 S113 G114 N115 N116 E145 W148 N152 A154 S155 G156 I161 W190 N194 S197 G198
External links