Structure of PDB 4cri Chain B Binding Site BS02

Receptor Information
>4cri Chain B (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILL
CDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRM
AVILSLEQGNRLREQYGLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cri Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
W1495 N1498 Y1500 Y1502 D1521 L1547 S1548 E1551 Y1552 F1553
Binding residue
(residue number reindexed from 1)
W11 N14 Y16 Y18 D37 L63 S64 E67 Y68 F69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cri, PDBe:4cri, PDBj:4cri
PDBsum4cri
PubMed25049398
UniProtQ12888|TP53B_HUMAN TP53-binding protein 1 (Gene Name=TP53BP1)

[Back to BioLiP]