Structure of PDB 4chg Chain B Binding Site BS02

Receptor Information
>4chg Chain B (length=133) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTD
EDTAALRRRLLQRFAIEPLAPVRDAEDAAAIHRRCRRGGDTVRSLIDCQV
AAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Ligand information
>4chg Chain H (length=29) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LVGEPLGRDEALALQGSGFDFSNDEIESF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4chg Crystal Structure of the Vapbc-15 Complex from Mycobacterium Tuberculosis Reveals a Two-Metal Ion Dependent Pin-Domain Ribonuclease And a Variable Mode of Toxin-Antitoxin Assembly.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S6 I9 Y11 L12 S13 S20 A24 D30 E42 I45 G46 K47 L55 R56 R58 L59 R62 S93 D96 D114
Binding residue
(residue number reindexed from 1)		S7 I10 Y12 L13 S14 S21 A25 D31 E43 I46 G47 K48 L56 R57 R59 L60 R63 S94 D97 D115
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4chg, PDBe:4chg, PDBj:4chg
PDBsum4chg
PubMed25450593
UniProtP9WF97|VPC15_MYCTU Ribonuclease VapC15 (Gene Name=vapC15)

[Back to BioLiP]