Structure of PDB 4c9d Chain B Binding Site BS02

Receptor Information
>4c9d Chain B (length=260) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASMPQAVVLELVGEKPPLYPARYAHGLFFALLSRVSPELAQKLHEAPRKP
FTLAPLPRTLKGTLRLRLTTLDDGLFAPFLRALLEAAPDGLPLGDSSYRL
ARVLATREGHPLAGATSWEELKEAPKREKATFRFLTPTVFATSKPGGRTR
YTPLPDPRLIAGSLLDKWQAHSPFPYNPKEEAALRELFELDLEVAGFRNL
RFHRVQAGKGFFPGFTGEATLRLWSQSLEAQEALGRLHALAFFSGVGAKT
PYGMGLAVPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4c9d Evolution of CRISPR RNA recognition and processing by Cas6 endonucleases.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H23 H42 P45 K47 F144 A145 T146 S147 K148 P149 T153 Y155 R162 L163 R208 K213 G214 G251 A252 K253 P255 Y256
Binding residue
(residue number reindexed from 1)		H25 H44 P47 K49 F140 A141 T142 S143 K144 P145 T149 Y151 R158 L159 R204 K209 G210 G247 A248 K249 P251 Y252
Binding affinityPDBbind-CN: Kd=3.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4c9d, PDBe:4c9d, PDBj:4c9d
PDBsum4c9d
PubMed24150936
UniProtQ53VU8

[Back to BioLiP]