Structure of PDB 4bxo Chain B Binding Site BS02

Receptor Information
>4bxo Chain B (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VHVPLGHIVANEKWRGSQLAEEMQGKIKLIFEDGLTPDFYLSNRCCILYV
TEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLD
LGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLSEPSLLRTVQQIPG
VGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bxo Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		G168 G170 V172 K173
Binding residue
(residue number reindexed from 1)		G150 G152 V154 K155
Binding affinityPDBbind-CN: Kd=1.85uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
Biological Process
GO:0006281 DNA repair
GO:0036297 interstrand cross-link repair
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle
GO:0043240 Fanconi anaemia nuclear complex
GO:0071821 FANCM-MHF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4bxo, PDBe:4bxo, PDBj:4bxo
PDBsum4bxo
PubMed23932590
UniProtQ9BTP7|FAP24_HUMAN Fanconi anemia core complex-associated protein 24 (Gene Name=FAAP24)

[Back to BioLiP]