Structure of PDB 4ati Chain B Binding Site BS02

Receptor Information
>4ati Chain B (length=71) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQKKDNHNLIERRRRFNINDRIKELGTLIPKSDPDMRWNKGTILKASVDY
IRKLQREQQRAKDLENRQKKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ati Restricted Leucine Zipper Dimerization and Specificity of DNA Recognition of the Melanocyte Master Regulator Mitf
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K206 H209 N210 E213 R214 R217 N242 K243
Binding residue
(residue number reindexed from 1)		K4 H7 N8 E11 R12 R15 N39 K40
Binding affinityPDBbind-CN: Kd=2.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4ati, PDBe:4ati, PDBj:4ati
PDBsum4ati
PubMed23207919
UniProtQ08874|MITF_MOUSE Microphthalmia-associated transcription factor (Gene Name=Mitf)

[Back to BioLiP]