Structure of PDB 4aqu Chain B Binding Site BS02

Receptor Information
>4aqu Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aqu 5'-Cytosine-Phosphoguanine (Cpg) Methylation Impacts the Activity of Natural and Engineered Meganucleases.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S232 Y233 K234 Q238 R268 R270 E280 I281 K316 D337 K339 T340
Binding residue
(residue number reindexed from 1)		S31 Y32 K33 Q37 R67 R69 E79 I80 K115 D136 K138 T139
Binding affinityPDBbind-CN: Kd=40.8nM
Enzymatic activity
Catalytic site (original residue number in PDB) G219 D220
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4aqu, PDBe:4aqu, PDBj:4aqu
PDBsum4aqu
PubMed22740697
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]