Structure of PDB 4aae Chain B Binding Site BS02

Receptor Information
>4aae Chain B (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aae Non-Specific Protein-DNA Interactions Control I-Crei Target Binding and Cleavage.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
S22 I24 Q26 K28 P29 N30 Q44 T46 K48 N136 D137 S138 T140 R141 K142
Binding residue
(residue number reindexed from 1)
S21 I23 Q25 K27 P28 N29 Q43 T45 K47 N135 D136 S137 T139 R140 K141
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4aae, PDBe:4aae, PDBj:4aae
PDBsum4aae
PubMed22495931
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]