Structure of PDB 3zql Chain B Binding Site BS02

Receptor Information
>3zql Chain B (length=226) Species: 1890 (Streptomyces antibioticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSIWMHPEPTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYY
YVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPW
LATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVES
FVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETV
APHMGPDQRFRSGLERLLDSIGASLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zql The Crystal Structure of the Tetr Family Transcriptional Repressor Simr Bound to DNA and the Role of a Flexible N-Terminal Extension in Minor Groove Binding.
Resolution2.99 Å
Binding residue
(original residue number in PDB)
S49 M50 R51 M62 Y65 T70 K71
Binding residue
(residue number reindexed from 1)
S33 M34 R35 M46 Y49 T54 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3zql, PDBe:3zql, PDBj:3zql
PDBsum3zql
PubMed21835774
UniProtQ9AMH9

[Back to BioLiP]