Structure of PDB 3zkc Chain B Binding Site BS02

Receptor Information
>3zkc Chain B (length=63) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKV
SAVLDVSVHTLLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zkc Molecular Basis of the Activity of Sinr, the Master Regulator of Biofilm Formation in Bacillus Subtilis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		V26 A27 S29 Y30 P42 S43
Binding residue
(residue number reindexed from 1)		V26 A27 S29 Y30 P42 S43
Binding affinityPDBbind-CN: Kd=360nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010629 negative regulation of gene expression
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zkc, PDBe:3zkc, PDBj:3zkc
PDBsum3zkc
PubMed23430750
UniProtP06533|SINR_BACSU HTH-type transcriptional regulator SinR (Gene Name=sinR)

[Back to BioLiP]