Structure of PDB 3wgi Chain B Binding Site BS02

Receptor Information
>3wgi Chain B (length=217) Species: 509192 (Thermoanaerobacter ethanolicus JW 200) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDL
NNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYT
SFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILC
IPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVS
YRLNEEELFKKLKGETA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wgi Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		S34 S35 R50 N54 G58 G60 Q62 G63 G65 Y66
Binding residue
(residue number reindexed from 1)		S31 S32 R47 N51 G55 G57 Q59 G60 G62 Y63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wgi, PDBe:3wgi, PDBj:3wgi
PDBsum3wgi
PubMed25463021
UniProtD5KM69

[Back to BioLiP]