Structure of PDB 3vw4 Chain B Binding Site BS02

Receptor Information
>3vw4 Chain B (length=120) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPL
SPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSAR
SLKPWEALGISRATYYRKLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vw4 Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein
Resolution2.7 Å
Binding residue
(original residue number in PDB)		A247 R252 G253 K255 G256 S260 K261 R262 I280 S281 T284 R287
Binding residue
(residue number reindexed from 1)		A77 R82 G83 K85 G86 S90 K91 R92 I110 S111 T114 R117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:3vw4, PDBe:3vw4, PDBj:3vw4
PDBsum3vw4
PubMed25538245
UniProtQ06B24

[Back to BioLiP]