Structure of PDB 3ulp Chain B Binding Site BS02

Receptor Information
>3ulp Chain B (length=114) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRTNELKS
KTDWHRIVVYDQNIVDLIDKYLRKGRRVYVQGSLHTRKWHTNDQPKQITE
IILSYNKGDLIFLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ulp Plasmodium falciparum SSB Tetramer Wraps Single-Stranded DNA with Similar Topology but Opposite Polarity to E. coli SSB.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L144 R153 F192
Binding residue
(residue number reindexed from 1)		L67 R76 F112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ulp, PDBe:3ulp, PDBj:3ulp
PDBsum3ulp
PubMed22543099
UniProtQ8I415

[Back to BioLiP]