Structure of PDB 3ts2 Chain B Binding Site BS02

Receptor Information
>3ts2 Chain B (length=137) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEG
FRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNC
GGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Ligand information
>3ts2 Chain V (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggucuaugauaccaccccggag
<<<<<..........>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ts2 Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
Resolution2.01 Å
Binding residue
(original residue number in PDB)		W46 N48 V49 R50 M51 F53 F55 D71 F73 H75 Q76 G83 F84 R85 S100 K102 E105 R122
Binding residue
(residue number reindexed from 1)		W13 N15 V16 R17 M18 F20 F22 D38 F40 H42 Q43 G50 F51 R52 S67 K69 E72 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3ts2, PDBe:3ts2, PDBj:3ts2
PDBsum3ts2
PubMed22078496
UniProtQ8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)

[Back to BioLiP]