Structure of PDB 3ssd Chain B Binding Site BS02

Receptor Information
>3ssd Chain B (length=148) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFAF
LGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKTI
AEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ssd The recognition domain of the methyl-specific endonuclease McrBC flips out 5-methylcytosine.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
Q21 S22 T23 K24 Y41 G42 N43
Binding residue
(residue number reindexed from 1)
Q19 S20 T21 K22 Y39 G40 N41
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:3ssd, PDBe:3ssd, PDBj:3ssd
PDBsum3ssd
PubMed22570415
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]