Structure of PDB 3rn5 Chain B Binding Site BS02

Receptor Information
>3rn5 Chain B (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTL
LKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKA
GETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGV
RNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rn5 Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
K204 E248 T249
Binding residue
(residue number reindexed from 1)
K58 E102 T103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:3rn5, PDBe:3rn5, PDBj:3rn5
PDBsum3rn5
PubMed22483801
UniProtO14862|AIM2_HUMAN Interferon-inducible protein AIM2 (Gene Name=AIM2)

[Back to BioLiP]