Structure of PDB 3rkq Chain B Binding Site BS02

Receptor Information
>3rkq Chain B (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWF
QNRRYKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rkq Crystal structure of the human NKX2.5 homeodomain in complex with DNA target.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R142 L144 F145 Q181 N188
Binding residue
(residue number reindexed from 1)		R6 L8 F9 Q45 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3rkq, PDBe:3rkq, PDBj:3rkq
PDBsum3rkq
PubMed22849347
UniProtP52952|NKX25_HUMAN Homeobox protein Nkx-2.5 (Gene Name=NKX2-5)

[Back to BioLiP]