Structure of PDB 3qjl Chain B Binding Site BS02

Receptor Information
>3qjl Chain B (length=240) Species: 53953 (Pyrococcus horikoshii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRIEVKLLPLKDNPILPFNYNYEVYSQILEKVNSIEPTIAKLLSSPHGF
WTFSRIIVRKRKILPDKGIEILSDDVSLYISSSNEDIIRAIAEAVEKSPE
FKIGELSFLVGDIKAIKVKELGKENVFSTLSPIVVRTVKFEGNKLRHWDL
YPHDELFMDRLRKVMILRYSEVMGETPKDRDFTIEVLKFKPTRLMVGSSY
IRGSLMVFRYAGSEEIARFGYENGFGEKTGLGFGMVKLIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qjl Cooperative and Specific Binding of a RAMP Protein to Single-stranded CRISPR Repeat RNA
Resolution2.7009 Å
Binding residue
(original residue number in PDB)		R2 V57 R58 R60 Y78 I115 K116 L186 K187 K236 I238 E239
Binding residue
(residue number reindexed from 1)		R3 V58 R59 R61 Y79 I116 K117 L187 K188 K237 I239 E240
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qjl, PDBe:3qjl, PDBj:3qjl
PDBsum3qjl
PubMed
UniProtO58088|CAS6L_PYRHO Putative CRISPR-associated endoribonuclease-like protein Cas6nc (Gene Name=cas6nc)

[Back to BioLiP]