Structure of PDB 3q5f Chain B Binding Site BS02

Receptor Information
>3q5f Chain B (length=140) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQL
AKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAE
MEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q5f Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
Resolution2.96 Å
Binding residue
(original residue number in PDB)		T30 T32 I58 E59 P61 S62 R65 R85 R86
Binding residue
(residue number reindexed from 1)		T28 T30 I56 E57 P59 S60 R63 R83 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3q5f, PDBe:3q5f, PDBj:3q5f
PDBsum3q5f
PubMed21550983
UniProtP40676|SLYA_SALTY Transcriptional regulator SlyA (Gene Name=slyA)

[Back to BioLiP]