Structure of PDB 3pvp Chain B Binding Site BS02

Receptor Information
>3pvp Chain B (length=95) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLP
KIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pvp Structural and Thermodynamic Signatures of DNA Recognition by Mycobacterium tuberculosis DnaA.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K436 R438 S458 L459 P460 H470 M474
Binding residue
(residue number reindexed from 1)		K26 R28 S48 L49 P50 H60 M64
Binding affinityPDBbind-CN: Kd=60nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005524 ATP binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006270 DNA replication initiation
GO:0006275 regulation of DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3pvp, PDBe:3pvp, PDBj:3pvp
PDBsum3pvp
PubMed21620858
UniProtA5TY69|DNAA_MYCTA Chromosomal replication initiator protein DnaA (Gene Name=dnaA)

[Back to BioLiP]