Structure of PDB 3pvi Chain B Binding Site BS02

Receptor Information
>3pvi Chain B (length=156) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHPDLNKLLELWPHIQEYQDLALKHGINDIFQGNGGKLLQVLLITGLTVL
PGREGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKYRQVPWIF
AIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVME
HGTKIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pvi Asp34 of PvuII endonuclease is directly involved in DNA minor groove recognition and indirectly involved in catalysis.
Resolution1.59 Å
Binding residue
(original residue number in PDB)		Q33 H84 Y123 N140
Binding residue
(residue number reindexed from 1)		Q32 H83 Y122 N139
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3pvi, PDBe:3pvi, PDBj:3pvi
PDBsum3pvi
PubMed9878366
UniProtP23657|T2P2_PROHU Type II restriction enzyme PvuII (Gene Name=pvuIIR)

[Back to BioLiP]