Structure of PDB 3og8 Chain B Binding Site BS02

Receptor Information
>3og8 Chain B (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKENKKLLCRKCKALACYTADVRVIEESHYTVLGDAFKECFVSRPHPKP
KQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDPAEMSKLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3og8 Crystal structure of RIG-I C-terminal domain bound to blunt-ended double-strand RNA without 5' triphosphate.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
H830 F853 K858 G874 I875 V886 K888 K907 W908
Binding residue
(residue number reindexed from 1)
H30 F53 K58 G74 I75 V86 K88 K107 W108
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links
PDB RCSB:3og8, PDBe:3og8, PDBj:3og8
PDBsum3og8
PubMed20961956
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]