Structure of PDB 3oa6 Chain B Binding Site BS02

Receptor Information
>3oa6 Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNG
WNRSWDRWAAEDHVLRDTDENRRLQRKLARKAVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oa6 Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
H55 N57 G58 N60
Binding residue
(residue number reindexed from 1)
H47 N49 G50 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3oa6, PDBe:3oa6, PDBj:3oa6
PDBsum3oa6
PubMed20657587
UniProtQ8N5Y2|MS3L1_HUMAN MSL complex subunit 3 (Gene Name=MSL3)

[Back to BioLiP]