Structure of PDB 3o9x Chain B Binding Site BS02

Receptor Information
>3o9x Chain B (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEE
SDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAF
SRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o9x Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
Resolution2.0999 Å
Binding residue
(original residue number in PDB)		F22 R23 G93 G94 N97 R101 Y102 Q108
Binding residue
(residue number reindexed from 1)		F23 R24 G94 G95 N98 R102 Y103 Q109
Binding affinityPDBbind-CN: Kd=0.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0044010 single-species biofilm formation
Cellular Component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o9x, PDBe:3o9x, PDBj:3o9x
PDBsum3o9x
PubMed21068382
UniProtQ46864|MQSA_ECOLI Antitoxin MqsA (Gene Name=mqsA)

[Back to BioLiP]