Structure of PDB 3nh1 Chain B Binding Site BS02

Receptor Information

>3nh1 Chain B (length=209) Species: 562 (Escherichia coli)

NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLM
PDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVV
RKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAA
LAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKR
LGGWPLSAA

Ligand information

>3nh1 Chain F (length=5)

atagg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3nh1 Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
• Resolution: 2.107 Å
• Binding residue (original residue number in PDB): E25 T26 F29 E73 F77 N78 H120 N121 F124 V163 H181
• Binding residue (residue number reindexed from 1): E22 T23 F26 E70 F74 N75 H117 N118 F121 V160 H178

Enzymatic activity

• Enzyme Commision number: 3.1.13.-

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006396 RNA processing
• GO:0006974 DNA damage response
• GO:0008033 tRNA processing
• GO:0031125 rRNA 3'-end processing
• GO:0034644 cellular response to UV
• GO:0042780 tRNA 3'-end processing
• GO:0043628 regulatory ncRNA 3'-end processing
• GO:0045004 DNA replication proofreading

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3nh1, PDBe:3nh1, PDBj:3nh1
• PDBsum: 3nh1
• PubMed: 21317904
• UniProt: P30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)