Structure of PDB 3ndh Chain B Binding Site BS02

Receptor Information
>3ndh Chain B (length=208) Species: 2303 (Thermoplasma acidophilum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHLKDLFRDRLIIDKVQRRLPYMFQLAELESSRAGKVGMEVGSLRERIIS
SLLIYKFGEKNVETDLPITEPEIDVKLFGSPISIKTITGKEPAGVKLIWT
VDATKARQFLETWHPRFDLILVHINWSSLGGVYYIPDYVQQRIFDEIGKD
KYIKLPKQGTNPRGVEISNEALKEIMTDEETMSIKIEWKKTNVQYNAFKR
WVDLWSEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ndh DNA intercalation without flipping in the specific ThaI-DNA complex
Resolution1.3 Å
Binding residue
(original residue number in PDB)		K44 V45 M47 E48 G50 S51 R53 T77 E78 D82 T94 I95 T96 K104 W107 K113 R171
Binding residue
(residue number reindexed from 1)		K36 V37 M39 E40 G42 S43 R45 T69 E70 D74 T86 I87 T88 K96 W99 K105 R163
Enzymatic activity
Enzyme Commision number ?
External links