Structure of PDB 3mwm Chain B Binding Site BS02

Receptor Information

>3mwm Chain B (length=125) Species: 1902 (Streptomyces coelicolor)

RATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLAD
AGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEA
IAAEHGYVNVAHTVEIFGTCADCAG

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3mwm Chain B Residue 141

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mwm Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): C90 C93 C133
• Binding residue (residue number reindexed from 1): C80 C83 C123
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900376 regulation of secondary metabolite biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3mwm, PDBe:3mwm, PDBj:3mwm
• PDBsum: 3mwm
• PubMed: 21383173
• UniProt: Q9L2H5