Structure of PDB 3mlo Chain B Binding Site BS02

Receptor Information
>3mlo Chain B (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEI
ERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSM
TKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIID
RFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFV
HNNSKHGENLYFQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mlo Structure of an Ebf1:DNA complex reveals unusual DNA recognition and structural homology with Rel proteins
Resolution3.01 Å
Binding residue
(original residue number in PDB)		R63 N66 F67 H157 C161 S162 R163 N172 A202 G203 N204 S238 K239
Binding residue
(residue number reindexed from 1)		R29 N32 F33 H123 C127 S128 R129 N138 A168 G169 N170 S204 K205
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3mlo, PDBe:3mlo, PDBj:3mlo
PDBsum3mlo
PubMed20876732
UniProtQ07802|COE1_MOUSE Transcription factor COE1 (Gene Name=Ebf1)

[Back to BioLiP]