Structure of PDB 3mky Chain B Binding Site BS02

Receptor Information
>3mky Chain B (length=115) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSV
VALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADE
VITLLTSVLKTSSAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mky Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		R163 S189 K191 I192 R195 S217 A218 R219
Binding residue
(residue number reindexed from 1)		R7 S33 K35 I36 R39 S61 A62 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3mky, PDBe:3mky, PDBj:3mky
PDBsum3mky
PubMed20236989
UniProtP62558|SOPB_ECOLI Protein SopB (Gene Name=sopB)

[Back to BioLiP]