Structure of PDB 3lap Chain B Binding Site BS02

Receptor Information
>3lap Chain B (length=149) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGA
VKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPP
GAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lap crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		S36 Q37 Q53 A54 S57 K67 Y78
Binding residue
(residue number reindexed from 1)		S21 Q22 Q38 A39 S42 K52 Y63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0034618 arginine binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006525 arginine metabolic process
GO:0006526 L-arginine biosynthetic process
GO:0051259 protein complex oligomerization
GO:1900079 regulation of arginine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lap, PDBe:3lap, PDBj:3lap
PDBsum3lap
PubMed20382162
UniProtP9WPY9|ARGR_MYCTU Arginine repressor (Gene Name=argR)

[Back to BioLiP]