Structure of PDB 3l1p Chain B Binding Site BS02

Receptor Information
>3l1p Chain B (length=145) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEA
LQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSQARKRKRTSIENRVRW
SLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3l1p A unique Oct4 interface is crucial for reprogramming to pluripotency
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S43 T45 T46 R49 S56 N59 R95 R97 K117 R138 R145 Q146
Binding residue
(residue number reindexed from 1)		S41 T43 T44 R47 S54 N57 R89 R91 K111 R132 R139 Q140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3l1p, PDBe:3l1p, PDBj:3l1p
PDBsum3l1p
PubMed23376973
UniProtP20263|PO5F1_MOUSE POU domain, class 5, transcription factor 1 (Gene Name=Pou5f1)

[Back to BioLiP]