Structure of PDB 3ktv Chain B Binding Site BS02

Receptor Information
>3ktv Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLN
VFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAA
EMIPKL
Ligand information
>3ktv Chain C (length=108) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggcaucaauauggugaccucccgggagcgggggaccaccagguugccu
aaggaggggugaaccggcccaggucggaaacggagcaggucaaaacuccc
gugcugua
<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>>>.>>>>...
.....<<<<<......<<<....<<<....>>>....>>>....>>>>>.
>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ktv Structural insights into the assembly of the human and archaeal signal recognition particles.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		S38 K39 L95 V96 Y107
Binding residue
(residue number reindexed from 1)		S29 K30 L86 V87 Y98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ktv, PDBe:3ktv, PDBj:3ktv
PDBsum3ktv
PubMed20179341
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]