Structure of PDB 3kmz Chain B Binding Site BS02

Receptor Information
>3kmz Chain B (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSE
LSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPE
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLS
AICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMK
ITDLRSISAKGAERVITLKME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kmz A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		N212 V218 D221
Binding residue
(residue number reindexed from 1)		N32 V38 D41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kmz, PDBe:3kmz, PDBj:3kmz
PDBsum3kmz
PubMed20543827
UniProtP10276|RARA_HUMAN Retinoic acid receptor alpha (Gene Name=RARA)

[Back to BioLiP]