Structure of PDB 3jso Chain B Binding Site BS02

Receptor Information

>3jso Chain B (length=189) Species: 83333 (Escherichia coli K-12)

KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALA
RKGVIEIVSGASRGIRLLGLPLVGRVAAGEIEGHYQVDPSLFKPNADFLL
RVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGN
KVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL

Ligand information

>3jso Chain D (length=22)

tatactgtatatatatacagta

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jso Structure of the LexA-DNA complex and implications for SOS box measurement.
• Resolution: 2.29 Å
• Binding residue (original residue number in PDB): T5 R7 F37 R38 S39 N41 A42 E45 H46 R52 G61 S63
• Binding residue (residue number reindexed from 1): T4 R6 F36 R37 S38 N40 A41 E44 H45 R51 G60 S62
• Binding affinity: PDBbind-CN: Kd=0.80nM

Enzymatic activity

• Catalytic site (original residue number in PDB): M118 S119 E152 A156
• Catalytic site (residue number reindexed from 1): M105 S106 E139 A143
• Enzyme Commision number: 3.4.21.88: repressor LexA.

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0006281 DNA repair
• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0006508 proteolysis
• GO:0006974 DNA damage response
• GO:0009432 SOS response
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3jso, PDBe:3jso, PDBj:3jso
• PDBsum: 3jso
• PubMed: 20703307
• UniProt: P0A7C2|LEXA_ECOLI LexA repressor (Gene Name=lexA)