Structure of PDB 3jrv Chain B Binding Site BS02

Receptor Information
>3jrv Chain B (length=144) Species: 10254 (Vaccinia virus WR) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYEDAVFYFVDDDKICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYK
ELMKFDDVAIRYYGIDKINEIVEAMSEGDHYINFTKVHDQESLFATIGIC
AKITEHWGYKKISESRFQSLGNITDLMTDDNINILILFLEKKLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jrv Structural basis for targeting of human RNA helicase DDX3 by poxvirus protein K7
Resolution1.6 Å
Binding residue
(original residue number in PDB)		V11 F12 Y13
Binding residue
(residue number reindexed from 1)		V6 F7 Y8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0140311 protein sequestering activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0052170 symbiont-mediated suppression of host innate immune response
GO:0085034 symbiont-mediated suppression of host NF-kappaB cascade
Cellular Component
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jrv, PDBe:3jrv, PDBj:3jrv
PDBsum3jrv
PubMed19913487
UniProtP68466|PG044_VACCW Protein K7 (Gene Name=OPG044)

[Back to BioLiP]