Structure of PDB 3j0q Chain B Binding Site BS02

Receptor Information
>3j0q Chain B (length=213) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSL
KLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKL
SKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRS
TIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGS
LVVKSSMGPAFRL
Ligand information
>3j0q Chain W (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j0q Structure and dynamics of the Mammalian ribosomal pretranslocation complex.
Resolution10.6 Å
Binding residue
(original residue number in PDB)		Q44 R45 V120 P121 R122 L123 P126 Q127 S129
Binding residue
(residue number reindexed from 1)		Q41 R42 V117 P118 R119 L120 P123 Q124 S126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j0q, PDBe:3j0q, PDBj:3j0q
PDBsum3j0q
PubMed22017870
UniProtP0CX43|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]