Structure of PDB 3ikt Chain B Binding Site BS02

Receptor Information
>3ikt Chain B (length=206) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVPEAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLS
YFGSYGTRGVGYTVPVLKRELRHILGLNRKWGLCIVGMGRLGSALADYPG
FGESFELRGFFDVDPEKVGRPVRGGVIEHVDLLPQRVPGRIEIALLTVPR
EAAQKAADLLVAAGIKGILNFAPVVLEVPKEVAVENVDFLAGLTRLSFAI
LNPKWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ikt Structural basis for NADH/NAD+ redox sensing by a Rex family repressor.
Resolution2.26 Å
Binding residue
(original residue number in PDB)		S30 S31 R46 K47 S54 G56 G59 V60 G61 Y62
Binding residue
(residue number reindexed from 1)		S30 S31 R46 K47 S54 G56 G59 V60 G61 Y62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ikt, PDBe:3ikt, PDBj:3ikt
PDBsum3ikt
PubMed20513431
UniProtQ72I39|REX_THET2 Redox-sensing transcriptional repressor Rex (Gene Name=rex)

[Back to BioLiP]