Structure of PDB 3iab Chain B Binding Site BS02

Receptor Information

>3iab Chain B (length=107) Species: 4932 (Saccharomyces cerevisiae)

RVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYV
AVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVIQLKKRAVSG
VELRIYV

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3iab Chain B Residue 142

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3iab Eukaryotic ribonucleases P/MRP: the crystal structure of the P3 domain
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): H26 H30
• Binding residue (residue number reindexed from 1): H13 H17
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 3.1.26.5: ribonuclease P.

Gene Ontology

Molecular Function

• GO:0000171 ribonuclease MRP activity
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004526 ribonuclease P activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
• GO:0000460 maturation of 5.8S rRNA
• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0034965 intronic box C/D snoRNA processing

Cellular Component

• GO:0000172 ribonuclease MRP complex
• GO:0005634 nucleus
• GO:0005655 nucleolar ribonuclease P complex
• GO:0005697 telomerase holoenzyme complex

External links

• PDB: RCSB:3iab, PDBe:3iab, PDBj:3iab
• PDBsum: 3iab
• PubMed: 20075859
• UniProt: P38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 (Gene Name=POP7)