Structure of PDB 3h9g Chain B Binding Site BS02

Receptor Information

>3h9g Chain B (length=340) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSS
YTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNNRYSRNFLHYQSYGA
NPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTN
LTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVP
EADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGK
TGCYECQKVVADLYKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVI
KFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG

Ligand information

>3h9g Chain F (length=7) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MRTGNAN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3h9g How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	D214 I220 Y239 Y258 V264 A265 L267 F286 R322 G324 Q335
Binding residue (residue number reindexed from 1)	D210 I216 Y235 Y254 V260 A261 L263 F279 R315 G317 Q328

Enzymatic activity

Catalytic site (original residue number in PDB)	R157
Catalytic site (residue number reindexed from 1)	R153
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0004792	thiosulfate sulfurtransferase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008641	ubiquitin-like modifier activating enzyme activity
GO:0016779	nucleotidyltransferase activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:3h9g, PDBe:3h9g, PDBj:3h9g
PDBsum	3h9g
PubMed	19494832
UniProt	Q47506

[Back to BioLiP]