Structure of PDB 3h0d Chain B Binding Site BS02

Receptor Information
>3h0d Chain B (length=151) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NISDIIEQYLKQVLNMSDQDIVEIKRSEIANKFRCVPSQINYVINTRFTL
ERGYIVESKRGGGGYIRIMKVKTKSEAQLIDQLLELIDHRISQSSAEDVI
KRLMEEKVISEREAKMMLSVMDRSVLYIDLPERDELRARMLKAMLTSLKY
K
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h0d McsB is a protein arginine kinase that phosphorylates and inhibits the heat-shock regulator CtsR
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N3 I4 S5 V38 S40 Q41 Y44 R49 R62
Binding residue
(residue number reindexed from 1)		N1 I2 S3 V36 S38 Q39 Y42 R47 R60
Binding affinityPDBbind-CN: Kd=22.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3h0d, PDBe:3h0d, PDBj:3h0d
PDBsum3h0d
PubMed19498169
UniProtC3W947|CTSR_GEOSE Transcriptional regulator CtsR (Gene Name=ctsr)

[Back to BioLiP]